PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT01578
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 178aa    MW: 19535.9 Da    PI: 8.9719
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT01578genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.5e-32100158159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver aed ++v++tYeg+H+h+
  EMT01578 100 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLAEDCRLVITTYEGRHTHT 158
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-3385158IPR003657WRKY domain
SuperFamilySSF1182901.29E-2892158IPR003657WRKY domain
PROSITE profilePS5081128.43895157IPR003657WRKY domain
SMARTSM007743.7E-37100159IPR003657WRKY domain
PfamPF031065.2E-25101157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MFSSDHGGGL YPLLPGIPFC HSAAACEKST GFAPLGGTGE AGTSAARAGN EFASATTTTT  60
ASCHGPSSWW KGAEKGKMKV RRKMREPRFC FQTRSEVDVL DDGYKWRKYG QKVVKNSLHP  120
RSYYRCTHSN CRVKKRVERL AEDCRLVITT YEGRHTHTPC SDDDAGGDHT GSCAFTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2691157874Probable WRKY transcription factor 4
2lex_A2e-2691157874Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654320.0EU665432.1 Triticum aestivum WRKY3 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751531.11e-102PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY48e-60WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLN1QSU21e-131N1QSU2_AEGTA; Putative WRKY transcription factor 12
STRINGMLOC_66345.11e-118(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.13e-59WRKY family protein